C9orf102 polyclonal antibody View larger

C9orf102 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf102 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C9orf102 polyclonal antibody

Brand: Abnova
Reference: PAB21377
Product name: C9orf102 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C9orf102.
Isotype: IgG
Gene id: 375748
Gene name: C9orf102
Gene alias: FLJ37706|MGC30192|MGC43364|RAD26L|SR278
Gene description: chromosome 9 open reading frame 102
Immunogen: Recombinant protein corresponding to amino acids of human C9orf102.
Immunogen sequence/protein sequence: SYFNSSSVNEFAKHITNATSEERQKMLRDFYASQYPEVKEFFVDSVSQFNNSSFEKGEQRTRKKSDKRESLIKPRLSDSETLSFKDSTN
Protein accession: Q5T890
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:1000-1:2500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21377-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with C9orf102 polyclonal antibody (Cat # PAB21377) shows strong positivity in exocrine pancreas at 1:1000-1:2500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C9orf102 polyclonal antibody now

Add to cart