GTPBP10 polyclonal antibody View larger

GTPBP10 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GTPBP10 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about GTPBP10 polyclonal antibody

Brand: Abnova
Reference: PAB21354
Product name: GTPBP10 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GTPBP10.
Isotype: IgG
Gene id: 85865
Gene name: GTPBP10
Gene alias: DKFZp686A10121|FLJ38242|MGC104191|ObgH2|UG0751c10
Gene description: GTP-binding protein 10 (putative)
Immunogen: Recombinant protein corresponding to amino acids of human GTPBP10.
Immunogen sequence/protein sequence: ALKGSKGKDCEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAF
Protein accession: A4D1E9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21354-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: human plasma, Lane 4: liver, Lane 5: tonsil GTPBP10 polyclonal antibody (Cat # PAB21354).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy GTPBP10 polyclonal antibody now

Add to cart