MURC polyclonal antibody View larger

MURC polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MURC polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about MURC polyclonal antibody

Brand: Abnova
Reference: PAB21341
Product name: MURC polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant MURC.
Isotype: IgG
Gene id: 347273
Gene name: MURC
Gene alias: -
Gene description: muscle-restricted coiled-coil protein
Immunogen: Recombinant protein corresponding to amino acids of human MURC.
Immunogen sequence/protein sequence: KGKDRTVAEGEECAREMGVDIIARSESLGPISELYSDELSEPEHEAARPVYPPHEGREIPTPEPLKVTFKSQVKVEDDESLLL
Protein accession: Q5BKX8
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21341-48-43-1.jpg
Application image note: Immunohistochemical staining of human skeletal muscle with MURC polyclonal antibody (Cat # PAB21341) shows distinct cytoplasmic and membranous positivity in myocytes at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy MURC polyclonal antibody now

Add to cart