SVEP1 polyclonal antibody View larger

SVEP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SVEP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SVEP1 polyclonal antibody

Brand: Abnova
Reference: PAB21316
Product name: SVEP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SVEP1.
Isotype: IgG
Gene id: 79987
Gene name: SVEP1
Gene alias: C9orf13|CCP22|FLJ16013|FLJ90719|POLYDOM|SEL-OB|SELOB
Gene description: sushi, von Willebrand factor type A, EGF and pentraxin domain containing 1
Immunogen: Recombinant protein corresponding to amino acids of human SVEP1.
Immunogen sequence/protein sequence: NRLDYSYDDFLDTVQETATSIGNAKSSRIKRSAPLSDYKIKLIFNITASVPLPDERNDTLEWENQQRLLQTLETITNKLKRTLNKDPMYSFQLASEIL
Protein accession: Q4LDE5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21316-48-41-1.jpg
Application image note: Immunohistochemical staining of human placenta with SVEP1 polyclonal antibody (Cat # PAB21316) shows strong cytoplasmic positivity in trophoblastic cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SVEP1 polyclonal antibody now

Add to cart