NCKAP1 polyclonal antibody View larger

NCKAP1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NCKAP1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about NCKAP1 polyclonal antibody

Brand: Abnova
Reference: PAB21299
Product name: NCKAP1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant NCKAP1.
Isotype: IgG
Gene id: 10787
Gene name: NCKAP1
Gene alias: FLJ11291|HEM2|KIAA0587|MGC8981|NAP1|NAP125
Gene description: NCK-associated protein 1
Immunogen: Recombinant protein corresponding to amino acids of human NCKAP1.
Immunogen sequence/protein sequence: LSFRSLAQEALRDVLSYHIPFLVSSIEDFKDHIPRETDMKVAMNVYELSSAAGLPCEIDPALVVALSSQKSENISPEEEY
Protein accession: Q9Y2A7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21299-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with NCKAP1 polyclonal antibody (Cat # PAB21299) shows strong cytoplasmic positivity in Purkinje cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NCKAP1 polyclonal antibody now

Add to cart