ATG2B polyclonal antibody View larger

ATG2B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ATG2B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ATG2B polyclonal antibody

Brand: Abnova
Reference: PAB21230
Product name: ATG2B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ATG2B.
Isotype: IgG
Gene id: 55102
Gene name: ATG2B
Gene alias: C14orf103|FLJ10242
Gene description: ATG2 autophagy related 2 homolog B (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human ATG2B.
Immunogen sequence/protein sequence: SQIQEPCCSDLFLFPDESGNVSQESGPTYASFSHHFISDAMTGVPTENDDFCILFAPKAAMQEKEEEPVIKIMVDDAIVIRDNYFSLPVNKTDTSKAPLHFPIPVIRYVVKEVSLVWHLYGGKDFGTVPPTSPA
Protein accession: Q96BY7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21230-48-52-1.jpg
Application image note: Immunohistochemical staining of human cerebellum with ATG2B polyclonal antibody (Cat # PAB21230) shows strong cytoplasmic positivity in Purkinje cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ATG2B polyclonal antibody now

Add to cart