GCN1L1 polyclonal antibody View larger

GCN1L1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GCN1L1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about GCN1L1 polyclonal antibody

Brand: Abnova
Reference: PAB21227
Product name: GCN1L1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GCN1L1.
Isotype: IgG
Gene id: 10985
Gene name: GCN1L1
Gene alias: GCN1|GCN1L|KIAA0219
Gene description: GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
Immunogen: Recombinant protein corresponding to amino acids of human GCN1L1.
Immunogen sequence/protein sequence: ALKEKLGTPDEQLEMANCQAVILSVEDDTGHRIIIEDLLEATRSPEVGMRQAAAIILNIYCSRSKADYTSHLRSLVSGLIRLFNDSSPVVLEESWDALNAITKKLDAGNQLALIEELHKEIRLIGNESKGEHVPGFC
Protein accession: Q92616
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21227-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with GCN1L1 polyclonal antibody (Cat # PAB21227) at 1-4 ug/mL dilution shows positivity in cytoplasm.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy GCN1L1 polyclonal antibody now

Add to cart