HEMGN polyclonal antibody View larger

HEMGN polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HEMGN polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about HEMGN polyclonal antibody

Brand: Abnova
Reference: PAB21223
Product name: HEMGN polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant HEMGN.
Isotype: IgG
Gene id: 55363
Gene name: HEMGN
Gene alias: EDAG|EDAG-1
Gene description: hemogen
Immunogen: Recombinant protein corresponding to amino acids of human HEMGN.
Immunogen sequence/protein sequence: GKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPI
Protein accession: Q9BXL5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21223-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with HEMGN polyclonal antibody (Cat # PAB21223) shows strong cytoplasmic and nuclear positivity in bone marrow poietic cells at 1:500-1:1000 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy HEMGN polyclonal antibody now

Add to cart