FAM219A polyclonal antibody View larger

FAM219A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM219A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about FAM219A polyclonal antibody

Brand: Abnova
Reference: PAB21199
Product name: FAM219A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM219A.
Isotype: IgG
Gene id: 203259
Gene name: FAM219A
Gene alias: RP11-573M23.5|C9orf25|bA573M23.5
Gene description: family with sequence similarity 219, member A
Immunogen: Recombinant protein corresponding to amino acids of human FAM219A.
Immunogen sequence/protein sequence: MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM
Protein accession: Q8IW50
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21199-48-A7-1.jpg
Application image note: Immunohistochemical staining of human pancreas with FAM219A polyclonal antibody (Cat # PAB21199) shows ditinct positivity in intercalated ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy FAM219A polyclonal antibody now

Add to cart