C19orf18 polyclonal antibody View larger

C19orf18 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C19orf18 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about C19orf18 polyclonal antibody

Brand: Abnova
Reference: PAB21127
Product name: C19orf18 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C19orf18.
Isotype: IgG
Gene id: 147685
Gene name: C19orf18
Gene alias: MGC41906
Gene description: chromosome 19 open reading frame 18
Immunogen: Recombinant protein corresponding to amino acids of human C19orf18.
Immunogen sequence/protein sequence: HPTGNITGLPGSKRSQPPRNITKEPKVFFHKTQLPGIQGAASRSTAASPTNPMKFLRNKAIIRHRPALVK
Protein accession: Q8NEA5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21127-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with C19orf18 polyclonal antibody (Cat # PAB21127) shows cytoplasmic positivity with a granular pattern in neuronal cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy C19orf18 polyclonal antibody now

Add to cart