LTA4H polyclonal antibody View larger

LTA4H polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LTA4H polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about LTA4H polyclonal antibody

Brand: Abnova
Reference: PAB21110
Product name: LTA4H polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LTA4H.
Isotype: IgG
Gene id: 4048
Gene name: LTA4H
Gene alias: -
Gene description: leukotriene A4 hydrolase
Immunogen: Recombinant protein corresponding to amino acids of human LTA4H.
Immunogen sequence/protein sequence: ALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGERQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGET
Protein accession: P09960
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21110-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with LTA4H polyclonal antibody (Cat # PAB21110).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy LTA4H polyclonal antibody now

Add to cart