CMC2 polyclonal antibody View larger

CMC2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CMC2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CMC2 polyclonal antibody

Brand: Abnova
Reference: PAB21107
Product name: CMC2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CMC2.
Isotype: IgG
Gene id: 56942
Gene name: CMC2
Gene alias: DC13|2310061C15Rik|C16orf61
Gene description: COX assembly mitochondrial protein 2 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human CMC2.
Immunogen sequence/protein sequence: MHPDLSPHLHTEECNVLINLLKECHKNHNILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKL
Protein accession: Q9NRP2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21107-48-A3-1.jpg
Application image note: Immunohistochemical staining of human stomach with CMC2 polyclonal antibody (Cat # PAB21107) shows strong cytoplasmic and membranous positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CMC2 polyclonal antibody now

Add to cart