SLC16A7 polyclonal antibody View larger

SLC16A7 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC16A7 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about SLC16A7 polyclonal antibody

Brand: Abnova
Reference: PAB21105
Product name: SLC16A7 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC16A7.
Isotype: IgG
Gene id: 9194
Gene name: SLC16A7
Gene alias: MCT2
Gene description: solute carrier family 16, member 7 (monocarboxylic acid transporter 2)
Immunogen: Recombinant protein corresponding to amino acids of human SLC16A7.
Immunogen sequence/protein sequence: GPNQTTSKSKNKTGKTEDDSSPKKIKTKKSTWEKVNKYLDFS
Protein accession: O60669
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21105-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with SLC16A7 polyclonal antibody (Cat # PAB21105) shows moderate cytoplasmic positivity in neuronal cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SLC16A7 polyclonal antibody now

Add to cart