FAM118A polyclonal antibody View larger

FAM118A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FAM118A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about FAM118A polyclonal antibody

Brand: Abnova
Reference: PAB21091
Product name: FAM118A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant FAM118A.
Isotype: IgG
Gene id: 55007
Gene name: FAM118A
Gene alias: C22orf8|FLJ20635
Gene description: family with sequence similarity 118, member A
Immunogen: Recombinant protein corresponding to amino acids of human FAM118A.
Immunogen sequence/protein sequence: VTQDAEVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVLKENEDHFFKHQADMLLHGIKVVSYGDCFDHFPGYVQDLATQICKQQSPDADRVDSTTLLGNACQDCAKRKLEENGIE
Protein accession: Q9NWS6
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21091-48-300-1.jpg
Application image note: Immunohistochemical staining of human corpus, uterine with FAM118A polyclonal antibody (Cat # PAB21091) shows strong cytoplasmic positivity in glandular cells and endothelial cells.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy FAM118A polyclonal antibody now

Add to cart