STARD3NL polyclonal antibody View larger

STARD3NL polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of STARD3NL polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about STARD3NL polyclonal antibody

Brand: Abnova
Reference: PAB21065
Product name: STARD3NL polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant STARD3NL.
Isotype: IgG
Gene id: 83930
Gene name: STARD3NL
Gene alias: MENTHO|MGC3251
Gene description: STARD3 N-terminal like
Immunogen: Recombinant protein corresponding to amino acids of human STARD3NL.
Immunogen sequence/protein sequence: MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRR
Protein accession: O95772
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21065-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with STARD3NL polyclonal antibody (Cat # PAB21065) shows cytoplasmic positivity in glandular cells at 1:50-1:200 dilution.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy STARD3NL polyclonal antibody now

Add to cart