TET1 polyclonal antibody View larger

TET1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TET1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about TET1 polyclonal antibody

Brand: Abnova
Reference: PAB21054
Product name: TET1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TET1.
Isotype: IgG
Gene id: 80312
Gene name: TET1
Gene alias: CXXC6|FLJ10839|FLJ41442|KIAA1676|LCX|bA119F7.1
Gene description: tet oncogene 1
Immunogen: Recombinant protein corresponding to amino acids of human TET1.
Immunogen sequence/protein sequence: VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT
Protein accession: Q8NFU7
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21054-48-43-1.jpg
Application image note: Immunohistochemical staining of human skeletal muscle with TET1 polyclonal antibody (Cat # PAB21054) shows moderate cytoplasmic positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: Epigenetic Modifications in the Biology of Nonalcoholic Fatty Liver Disease: The Role of DNA Hydroxymethylation and TET Proteins.Pirola CJ, Scian R, Gianotti TF, Dopazo H, Rohr C, Martino JS, Castano GO, Sookoian S.
Medicine (Baltimore). 2015 Sep;94(36):e1480

Reviews

Buy TET1 polyclonal antibody now

Add to cart