URB1 polyclonal antibody View larger

URB1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of URB1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about URB1 polyclonal antibody

Brand: Abnova
Reference: PAB21034
Product name: URB1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant URB1.
Isotype: IgG
Gene id: 9875
Gene name: URB1
Gene alias: C21orf108|KIAA0539|NPA1
Gene description: URB1 ribosome biogenesis 1 homolog (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human URB1.
Immunogen sequence/protein sequence: VEHHKTCRSLGRSLWQQPSVGDILRLLDRDRMMQTILHFPQNRRLLPPEDTQELIFKDKSRVDLDGLYDPCFLLQLFSELTRPEFVVDCRKFLDSNALGLTVTALSSYDP
Protein accession: O60287
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB21034-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with URB1 polyclonal antibody (Cat # PAB21034) at 1-4 ug/mL dilution shows positivity in nucleoli.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy URB1 polyclonal antibody now

Add to cart