TREML1 polyclonal antibody View larger

TREML1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TREML1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,WB-Tr

More info about TREML1 polyclonal antibody

Brand: Abnova
Reference: PAB20967
Product name: TREML1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant TREML1.
Isotype: IgG
Gene id: 340205
Gene name: TREML1
Gene alias: GLTL1825|MGC119173|PRO3438|TLT-1|TLT1|dJ238O23.3
Gene description: triggering receptor expressed on myeloid cells-like 1
Immunogen: Recombinant protein corresponding to amino acids of human TREML1.
Immunogen sequence/protein sequence: APVGSSILVQCHYRLQDVKAQKVWCRFLPEGCQPLVSSAVDRRAPAGRRTFLTDLGGGLLQVEMVTLQEEDAGEYGCMVDGARGPQILHRVSLNILPPEEEEETHKIGSLAENAFSDPAGSANPLEPSQD
Protein accession: Q86YW5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20967-48-70-1.jpg
Application image note: Immunohistochemical staining of human bone marrow with TREML1 polyclonal antibody (Cat # PAB20967) shows strong positivity in megakaryocytes.
Applications: IHC-P,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TREML1 polyclonal antibody now

Add to cart