DNAJC14 polyclonal antibody View larger

DNAJC14 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAJC14 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P,IF

More info about DNAJC14 polyclonal antibody

Brand: Abnova
Reference: PAB20951
Product name: DNAJC14 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAJC14.
Isotype: IgG
Gene id: 85406
Gene name: DNAJC14
Gene alias: DNAJ|DRIP78|HDJ3|LIP6
Gene description: DnaJ (Hsp40) homolog, subfamily C, member 14
Immunogen: Recombinant protein corresponding to amino acids of human DNAJC14.
Immunogen sequence/protein sequence: WGWLELPWVKQNINRQGNAPVASGRYCQPEEEVARLLTMAGVPEDELNPFHVLGVEATASDVELKKAYRQLAVMVHPDKNHHPRAEEAFKVLRAAWDIVSNAEKRKEYEMKRMAENELSRSVNEFLSKLQDDLKEAMNTMMCSRCQG
Protein accession: Q6Y2X3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB20951-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with DNAJC14 polyclonal antibody (Cat # PAB20951) shows cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: WB,WB-Ce,IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy DNAJC14 polyclonal antibody now

Add to cart