GALNAC4S-6ST polyclonal antibody View larger

GALNAC4S-6ST polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GALNAC4S-6ST polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GALNAC4S-6ST polyclonal antibody

Brand: Abnova
Reference: PAB20946
Product name: GALNAC4S-6ST polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GALNAC4S-6ST.
Isotype: IgG
Gene id: 51363
Gene name: GALNAC4S-6ST
Gene alias: BRAG|DKFZp781H1369|KIAA0598|MGC34346|RP11-47G11.1
Gene description: B cell RAG associated protein
Immunogen: Recombinant protein corresponding to amino acids of human GALNAC4S-6ST.
Immunogen sequence/protein sequence: GIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVER
Protein accession: Q7LFX5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20946-48-3-1.jpg
Application image note: Immunohistochemical staining of human heart muscle with GALNAC4S-6ST polyclonal antibody (Cat # PAB20946) shows strong positivity in myocytes.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GALNAC4S-6ST polyclonal antibody now

Add to cart