GPM6A polyclonal antibody View larger

GPM6A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GPM6A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about GPM6A polyclonal antibody

Brand: Abnova
Reference: PAB20939
Product name: GPM6A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant GPM6A.
Isotype: IgG
Gene id: 2823
Gene name: GPM6A
Gene alias: GPM6|M6A
Gene description: glycoprotein M6A
Immunogen: Recombinant protein corresponding to amino acids of human GPM6A.
Immunogen sequence/protein sequence: YFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELN
Protein accession: P51674
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20939-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with GPM6A polyclonal antibody (Cat # PAB20939) shows weak cytoplasmic positivity in glandular cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy GPM6A polyclonal antibody now

Add to cart