LRP12 polyclonal antibody View larger

LRP12 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LRP12 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LRP12 polyclonal antibody

Brand: Abnova
Reference: PAB20931
Product name: LRP12 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LRP12.
Isotype: IgG
Gene id: 29967
Gene name: LRP12
Gene alias: DKFZp781F1053|FLJ12929|ST7
Gene description: low density lipoprotein-related protein 12
Immunogen: Recombinant protein corresponding to amino acids of human LRP12.
Immunogen sequence/protein sequence: FPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSSNIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPLPQKVPPTTAVEATVGACASSS
Protein accession: Q9Y561
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20931-48-301-1.jpg
Application image note: Immunohistochemical staining of human epididymis with LRP12 polyclonal antibody (Cat # PAB20931) shows moderate cytoplasmic and nucleolar positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LRP12 polyclonal antibody now

Add to cart