CNPY3 polyclonal antibody View larger

CNPY3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNPY3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB-Ce,IHC-P

More info about CNPY3 polyclonal antibody

Brand: Abnova
Reference: PAB20883
Product name: CNPY3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CNPY3.
Isotype: IgG
Gene id: 10695
Gene name: CNPY3
Gene alias: CAG4A|ERDA5|PRAT4A|TNRC5
Gene description: canopy 3 homolog (zebrafish)
Immunogen: Recombinant protein corresponding to amino acids of human CNPY3.
Immunogen sequence/protein sequence: GVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDTAALGGKKSKKKSIRAKAAGGRSSSSKQRKEL
Protein accession: Q9BT09
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB20883-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with CNPY3 polyclonal antibody (Cat # PAB20883) shows strong cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CNPY3 polyclonal antibody now

Add to cart