PIGG polyclonal antibody View larger

PIGG polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIGG polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PIGG polyclonal antibody

Brand: Abnova
Reference: PAB20864
Product name: PIGG polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PIGG.
Isotype: IgG
Gene id: 54872
Gene name: PIGG
Gene alias: DKFZp434A1810|DKFZp434C1712|DKFZp434M1131|FLJ20265|FLJ39925|GPI7|LAS21|MGC131903|PRO4405|RLGS1930
Gene description: phosphatidylinositol glycan anchor biosynthesis, class G
Immunogen: Recombinant protein corresponding to amino acids of human PIGG.
Immunogen sequence/protein sequence: VEYDGTTSFFVSDYTEVDNNVTRHLDKVLKRGDWDILILHYLGLDHIGHISGPNSPLIGQKLSEMDSVLMKIHTSLQSKERETPLPNLLVLCGDHGMSETGSHGASSTEEVNTPLILISSAFERKPGDIRHPKHVQQTDVA
Protein accession: Q5H8A4
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20864-48-36-1.jpg
Application image note: Immunohistochemical staining of human small intestine with PIGG polyclonal antibody (Cat # PAB20864) shows moderate cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PIGG polyclonal antibody now

Add to cart