APOBEC4 polyclonal antibody View larger

APOBEC4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APOBEC4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about APOBEC4 polyclonal antibody

Brand: Abnova
Reference: PAB20829
Product name: APOBEC4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant APOBEC4.
Isotype: IgG
Gene id: 403314
Gene name: APOBEC4
Gene alias: C1orf169|MGC26594
Gene description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 4 (putative)
Immunogen: Recombinant protein corresponding to amino acids of human APOBEC4.
Immunogen sequence/protein sequence: YEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTFPQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIILYSNNSPCNEANHC
Protein accession: Q8WW27
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20829-48-207-1.jpg
Application image note: Immunohistochemical staining of human blood vessel with APOBEC4 polyclonal antibody (Cat # PAB20829) shows distinct positivity in internal elastic lamina at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy APOBEC4 polyclonal antibody now

Add to cart