Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLCE1 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about PLCE1 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB20820 |
| Product name: | PLCE1 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant PLCE1. |
| Isotype: | IgG |
| Gene id: | 51196 |
| Gene name: | PLCE1 |
| Gene alias: | FLJ23659|KIAA1516|MGC167842|NPHS3|PLCE |
| Gene description: | phospholipase C, epsilon 1 |
| Immunogen: | Recombinant protein corresponding to amino acids of human PLCE1. |
| Immunogen sequence/protein sequence: | MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT |
| Protein accession: | Q9P212 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human colon with PLCE1 polyclonal antibody (Cat # PAB20820) shows strong cytoplasmic positivity in plasma cells. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Functional role of PLCE1 intronic insertion variant associated with susceptibility to esophageal squamous-cell carcinoma.Wei L, Shao M, Zhao Y, Zheng J, Chu J, Chang J, Cheng X, Qionghua C, Peng L, Luo Y, Tan W, Tan W, Lin D, Wu C. Carcinogenesis. 2017 Nov 2. [Epub ahead of print] |