UGCGL1 polyclonal antibody View larger

UGCGL1 polyclonal antibody

PAB20796_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of UGCGL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about UGCGL1 polyclonal antibody

Brand: Abnova
Reference: PAB20796
Product name: UGCGL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant UGCGL1.
Isotype: IgG
Gene id: 56886
Gene name: UGCGL1
Gene alias: FLJ23671|FLJ23796|HUGT1
Gene description: UDP-glucose ceramide glucosyltransferase-like 1
Immunogen: Recombinant protein corresponding to amino acids of human UGCGL1.
Immunogen sequence/protein sequence: KVKVEHVVSVLEKKYPYVEVNSILGIDSAYDRNRKEARGYYEQTGVGPLPVVLFNGMPFEREQLDPDELETITMHKILETTTFFQRAVYLGELPHDQDVVEYIMNQPNVVPRINSRILTAERDYLDLTASNNFFVDDYA
Protein accession: Q9NYU2
Form: Liquid
Recommend dilutions: Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20796-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with UGCGL1 polyclonal antibody (Cat # PAB20796).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy UGCGL1 polyclonal antibody now

Add to cart