EMP2 polyclonal antibody View larger

EMP2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EMP2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about EMP2 polyclonal antibody

Brand: Abnova
Reference: PAB20757
Product name: EMP2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant EMP2.
Isotype: IgG
Gene id: 2013
Gene name: EMP2
Gene alias: MGC9056|XMP
Gene description: epithelial membrane protein 2
Immunogen: Recombinant protein corresponding to amino acids of human EMP2.
Immunogen sequence/protein sequence: DNAWWVGDEFFADVWRICTNNTNCTVINDSFQEYST
Protein accession: P54851
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20757-48-A0-1.jpg
Application image note: Immunohistochemical staining of human kidney with EMP2 polyclonal antibody (Cat # PAB20757) shows strong cytoplasmic positivity in cells in glomeruli.
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy EMP2 polyclonal antibody now

Add to cart