C9orf123 polyclonal antibody View larger

C9orf123 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C9orf123 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about C9orf123 polyclonal antibody

Brand: Abnova
Reference: PAB20745
Product name: C9orf123 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C9orf123.
Isotype: IgG
Gene id: 90871
Gene name: C9orf123
Gene alias: MGC4730
Gene description: chromosome 9 open reading frame 123
Immunogen: Recombinant protein corresponding to amino acids of human C9orf123.
Immunogen sequence/protein sequence: MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAPTSPAEHRLLKTCWSC
Protein accession: Q96GE9
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20745-48-37-1.jpg
Application image note: Immunohistochemical staining of human gallbladder with C9orf123 polyclonal antibody (Cat # PAB20745) shows cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy C9orf123 polyclonal antibody now

Add to cart