SYDE1 polyclonal antibody View larger

SYDE1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SYDE1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SYDE1 polyclonal antibody

Brand: Abnova
Reference: PAB20647
Product name: SYDE1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SYDE1.
Isotype: IgG
Gene id: 85360
Gene name: SYDE1
Gene alias: 7h3|FLJ13511
Gene description: synapse defective 1, Rho GTPase, homolog 1 (C. elegans)
Immunogen: Recombinant protein corresponding to amino acids of human SYDE1.
Immunogen sequence/protein sequence: GDWSVCGRDFLPCGRDFLSGPDYDHVTGSDSEDEDEEVGEPRVTGDFEDDFDAPFNPHLNLKDFDALILDLERELSKQINV
Protein accession: Q6ZW31
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20647-48-4-1.jpg
Application image note: Immunohistochemical staining of human stomach with SYDE1 polyclonal antibody (Cat # PAB20647) shows strong cytoplasmic positivity in glandular cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SYDE1 polyclonal antibody now

Add to cart