C1RL polyclonal antibody View larger

C1RL polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of C1RL polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB,IHC-P

More info about C1RL polyclonal antibody

Brand: Abnova
Reference: PAB20548
Product name: C1RL polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant C1RL.
Isotype: IgG
Gene id: 51279
Gene name: C1RL
Gene alias: C1RL1|C1RLP|C1r-LP|CLSPa
Gene description: complement component 1, r subcomponent-like
Immunogen: Recombinant protein corresponding to amino acids of human C1RL.
Immunogen sequence/protein sequence: NVLPVCLPDNETLYRSGLLGYVSGFGMEMGWLTTELKYSRLPVAPREACNAWLQKRQRPEVFSDNMFCVGDETQ
Protein accession: Q9NZP8
Form: Liquid
Recommend dilutions: Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20548-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with C1RL polyclonal antibody (Cat # PAB20548).
Applications: WB,IHC-P
Shipping condition: Dry Ice

Reviews

Buy C1RL polyclonal antibody now

Add to cart