ANKS6 polyclonal antibody View larger

ANKS6 polyclonal antibody

PAB20423_100uL

New product

455,00 € tax excl.

100 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ANKS6 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ANKS6 polyclonal antibody

Brand: Abnova
Reference: PAB20423
Product name: ANKS6 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ANKS6.
Isotype: IgG
Gene id: 203286
Gene name: ANKS6
Gene alias: ANKRD14|DKFZp686D24121|DKFZp781I0117|MGC70366|SAMD6
Gene description: ankyrin repeat and sterile alpha motif domain containing 6
Immunogen: Recombinant protein corresponding to amino acids of human ANKS6.
Immunogen sequence/protein sequence: TSTTSKSTSPTLTPSPSPKGHTAESSVSSSSSHRQSKSSGGSSSGTITDEDELTGILKKLSLEKYQPIFEEQEVDMEAFLTLTDGDLKELGIKTDGSRQQILAAISELNAGKGRERQILQETIHNFHSSF
Protein accession: Q68DC2
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20423-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ANKS6 polyclonal antibody (Cat # PAB20423) shows strong cytoplasmic positivity in granular pattern in neuronal cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ANKS6 polyclonal antibody now

Add to cart