SEC23B polyclonal antibody View larger

SEC23B polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SEC23B polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P,IF

More info about SEC23B polyclonal antibody

Brand: Abnova
Reference: PAB20415
Product name: SEC23B polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SEC23B.
Isotype: IgG
Gene id: 10483
Gene name: SEC23B
Gene alias: -
Gene description: Sec23 homolog B (S. cerevisiae)
Immunogen: Recombinant protein corresponding to amino acids of human SEC23B.
Immunogen sequence/protein sequence: MVQVHELSCEGISKSYVFRGTKDLTAKQIQDMLGLTKPAMPMQQARPAQPQEHPFASSRFLQPVHKIDMNLTDLLGELQRDPWPVTQGKRPLRSTGV
Protein accession: Q15437
Form: Liquid
Recommend dilutions: Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20415-49-23-1.jpg
Application image note: Immunofluorescent staining of human cell line U-2 OS with SEC23B polyclonal antibody (Cat # PAB20415) at 1-4 ug/mL dilution shows positivity in vesicles.
Applications: IHC-P,IF
Shipping condition: Dry Ice

Reviews

Buy SEC23B polyclonal antibody now

Add to cart