Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RNF43 polyclonal antibody
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | IHC-P |
More info about RNF43 polyclonal antibody
| Brand: | Abnova |
| Reference: | PAB20409 |
| Product name: | RNF43 polyclonal antibody |
| Product description: | Rabbit polyclonal antibody raised against recombinant RNF43. |
| Isotype: | IgG |
| Gene id: | 54894 |
| Gene name: | RNF43 |
| Gene alias: | DKFZp781H02126|DKFZp781H0392|FLJ20315|FLJ77466|FLJ99338|MGC125630|RNF124|URCC |
| Gene description: | ring finger protein 43 |
| Immunogen: | Recombinant protein corresponding to amino acids of human RNF43. |
| Immunogen sequence/protein sequence: | CVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAHYHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSHLQSTSQH |
| Protein accession: | Q68DV7 |
| Form: | Liquid |
| Recommend dilutions: | Immunohistochemistry (1:50-1:200) The optimal working dilution should be determined by the end user. |
| Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
| Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
| Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunohistochemical staining of human kidney with RNF43 polyclonal antibody (Cat # PAB20409) shows strong nuclear positivity in cells in tubules. |
| Applications: | IHC-P |
| Shipping condition: | Dry Ice |
| Publications: | Frequent frameshift mutations in two mononucleotide repeats of RNF43 gene and its regional heterogeneity in gastric and colorectal cancers.Jo YS, Kim MS, Lee JH, Lee SH, An CH, Yoo NJ. Human Pathology. 2015 July 15. [Epub ahead of print] |