LY6G6F polyclonal antibody View larger

LY6G6F polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of LY6G6F polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about LY6G6F polyclonal antibody

Brand: Abnova
Reference: PAB20407
Product name: LY6G6F polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant LY6G6F.
Isotype: IgG
Gene id: 259215
Gene name: LY6G6F
Gene alias: C6orf21|G6f|LY6G6D|NG32
Gene description: lymphocyte antigen 6 complex, locus G6F
Immunogen: Recombinant protein corresponding to amino acids of human LY6G6F.
Immunogen sequence/protein sequence: LLGNYSLWLEGSKEEDAGRYWCAVLGQHHNYQNWRVYDVLVLKGSQLSARAADGSPCNVLLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPRSRRPRIIRCLMTHNKGVSFSLAASIDASPAL
Protein accession: Q5SQ64
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20407-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with LY6G6F polyclonal antibody (Cat # PAB20407) shows strong cytoplasmic positivity in cells in seminiferus ducts, leydig cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy LY6G6F polyclonal antibody now

Add to cart