IL1RL1 polyclonal antibody View larger

IL1RL1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about IL1RL1 polyclonal antibody

Brand: Abnova
Reference: PAB20396
Product name: IL1RL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant IL1RL1.
Isotype: IgG
Gene id: 9173
Gene name: IL1RL1
Gene alias: DER4|FIT-1|MGC32623|ST2|ST2L|ST2V|T1
Gene description: interleukin 1 receptor-like 1
Immunogen: Recombinant protein corresponding to amino acids of human IL1RL1.
Immunogen sequence/protein sequence: PSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRY
Protein accession: Q01638
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20396-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with IL1RL1 polyclonal antibody (Cat # PAB20396) shows strong cytoplasmic positivity in neuronal cells at 1:10-1:20 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy IL1RL1 polyclonal antibody now

Add to cart