ABCA3 polyclonal antibody View larger

ABCA3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ABCA3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ABCA3 polyclonal antibody

Brand: Abnova
Reference: PAB20394
Product name: ABCA3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ABCA3.
Isotype: IgG
Gene id: 21
Gene name: ABCA3
Gene alias: ABC-C|ABC3|EST111653|LBM180|MGC166979|MGC72201|SMDP3
Gene description: ATP-binding cassette, sub-family A (ABC1), member 3
Immunogen: Recombinant protein corresponding to amino acids of human ABCA3.
Immunogen sequence/protein sequence: MLRLTLGEYGRTVVPFSVPGTSQLGQQLSEHLKDALQAEGQEPREVLGDLEEFLIFRASVEGGGFNERCLVAASFRDVGERTVVNALFNNQAYHSPATALAVVDNLLFKLLCGPHASIVVSNFPQPRSALQAAKDQFNEG
Protein accession: Q99758
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20394-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with ABCA3 polyclonal antibody (Cat # PAB20394) shows strong cytoplasmic positivity in granular pattern in neuronal cells at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ABCA3 polyclonal antibody now

Add to cart