CCAR1 polyclonal antibody View larger

CCAR1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCAR1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesRabbit
ApplicationsWB,WB-Ce,IHC-P

More info about CCAR1 polyclonal antibody

Brand: Abnova
Reference: PAB20392
Product name: CCAR1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CCAR1.
Isotype: IgG
Gene id: 55749
Gene name: CCAR1
Gene alias: CARP-1|CARP1|MGC44628|RP11-437A18.1
Gene description: cell division cycle and apoptosis regulator 1
Immunogen: Recombinant protein corresponding to amino acids of human CCAR1.
Immunogen sequence/protein sequence: KDVEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDEKTILNLENSNKSLSGELREVKKDLSQLQENLKISENMNLQFENQMNKTIRNLSTVMDEIHTVLKKDNVKNED
Protein accession: Q8IX12
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: PAB20392-12-multi-1.jpg
Application image note: Western blot analysis of Lane 1: RT-4, Lane 2: U-251 MG, Lane 3: Human Plasma, Lane 4: Liver, Lane 5: Tonsil with CCAR1 polyclonal antibody (Cat # PAB20392).
Applications: WB,WB-Ce,IHC-P
Shipping condition: Dry Ice

Reviews

Buy CCAR1 polyclonal antibody now

Add to cart