SPINK4 polyclonal antibody View larger

SPINK4 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SPINK4 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SPINK4 polyclonal antibody

Brand: Abnova
Reference: PAB20369
Product name: SPINK4 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SPINK4.
Isotype: IgG
Gene id: 27290
Gene name: SPINK4
Gene alias: MGC133107|PEC-60
Gene description: serine peptidase inhibitor, Kazal type 4
Immunogen: Recombinant protein corresponding to amino acids of human SPINK4.
Immunogen sequence/protein sequence: LPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQDIQIMKDGK
Protein accession: O60575
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20369-48-7-1.jpg
Application image note: Immunohistochemical staining of human colon with SPINK4 polyclonal antibody (Cat # PAB20369) shows strong cytoplasmic positivity in goblet cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SPINK4 polyclonal antibody now

Add to cart