KANSL1 polyclonal antibody View larger

KANSL1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of KANSL1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about KANSL1 polyclonal antibody

Brand: Abnova
Reference: PAB20355
Product name: KANSL1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant KANSL1.
Isotype: IgG
Gene id: 284058
Gene name: KANSL1
Gene alias: CENP-36|KDVS|KIAA1267|MSL1v1|NSL1|hMSL1v1
Gene description: KAT8 regulatory NSL complex subunit 1
Immunogen: Recombinant protein corresponding to amino acids of human KANSL1.
Immunogen sequence/protein sequence: APLLERLSQLDSCVHPVLAFPDDVPTSLHFQSMLKSQWQNKPFDKIKPPKKLSLKHRAPMPGSLPDSARKDRHKLVSSFLTTAKLSHHQTRPDRTHRQHLDDVGAVPMVERVTAPKAERLLNPPPPVHDPNHSKMRLRDHSS
Protein accession: Q7Z3B3
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20355-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with KANSL1 polyclonal antibody (Cat # PAB20355) shows strong cytoplasmic and nuclear positivity in neuronal cells.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: NuMA recruits dynein activity to microtubule minus-ends at mitosis.Hueschen CL, Kenny SJ, Xu K, Dumont S.
Elife. 2017 Nov 29;6. pii: e29328.

Reviews

Buy KANSL1 polyclonal antibody now

Add to cart