SCN7A polyclonal antibody View larger

SCN7A polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCN7A polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SCN7A polyclonal antibody

Brand: Abnova
Reference: PAB20287
Product name: SCN7A polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SCN7A.
Isotype: IgG
Gene id: 6332
Gene name: SCN7A
Gene alias: SCN6A
Gene description: sodium channel, voltage-gated, type VII, alpha
Immunogen: Recombinant protein corresponding to amino acids of human SCN7A.
Immunogen sequence/protein sequence: LLKILCKTQNVPKDTMDHVNEVYVKEDISDHTLSELSNTQDFLKDKEKSSGTEKNATENESQSLIPSPSVSETVPIASGESDIENLDNKEIQSKSGDGGSKEK
Protein accession: Q01118
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20287-48-10-1.jpg
Application image note: Immunohistochemical staining of human lymph node with SCN7A polyclonal antibody (Cat # PAB20287) shows strong nuclear positivity in reaction center cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy SCN7A polyclonal antibody now

Add to cart