DNAAF2 polyclonal antibody View larger

DNAAF2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DNAAF2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about DNAAF2 polyclonal antibody

Brand: Abnova
Reference: PAB20263
Product name: DNAAF2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant DNAAF2.
Isotype: IgG
Gene id: 55172
Gene name: DNAAF2
Gene alias: C14orf104|CILD10|KTU|PF13
Gene description: dynein, axonemal, assembly factor 2
Immunogen: Recombinant protein corresponding to amino acids of human DNAAF2.
Immunogen sequence/protein sequence: GEPLCPPLLCNQDKETLTLLIQVPRIQPQSLQGDLNPLWYKLRFSAQDLVYSFFLQFAPENKLSTTEPVISISSNNAVIELAKSPESHGHWREWYYGVNNDSLE
Protein accession: Q9NVR5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20263-48-12-1.jpg
Application image note: Immunohistochemical staining of human testis with DNAAF2 polyclonal antibody (Cat # PAB20263) shows strong cytoplasmic positivity in leydig cells and subsets of cells in seminiferus ducts.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy DNAAF2 polyclonal antibody now

Add to cart