WASF1 polyclonal antibody View larger

WASF1 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of WASF1 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about WASF1 polyclonal antibody

Brand: Abnova
Reference: PAB20262
Product name: WASF1 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant WASF1.
Isotype: IgG
Gene id: 8936
Gene name: WASF1
Gene alias: FLJ31482|KIAA0269|SCAR1|WAVE|WAVE1
Gene description: WAS protein family, member 1
Immunogen: Recombinant protein corresponding to amino acids of human WASF1.
Immunogen sequence/protein sequence: PRAPHDRRREWQKLAQGPELAEDDANLLHKHIEVANGPASHFETRPQTYVDHMDGSYSLSALPFSQMSELLTRAEERVLVRPHEPPPPPPMHGAGDAKPIPTCISSATGLIENRPQSPATGRTPVFVSPTP
Protein accession: Q92558
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20262-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with WASF1 polyclonal antibody (Cat # PAB20262) shows strong cytoplasmic positivity in neuronal cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy WASF1 polyclonal antibody now

Add to cart