ZMYM3 polyclonal antibody View larger

ZMYM3 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZMYM3 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ZMYM3 polyclonal antibody

Brand: Abnova
Reference: PAB20178
Product name: ZMYM3 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZMYM3.
Isotype: IgG
Gene id: 9203
Gene name: ZMYM3
Gene alias: DXS6673E|KIAA0385|MYM|XFIM|ZNF198L2|ZNF261
Gene description: zinc finger, MYM-type 3
Immunogen: Recombinant protein corresponding to amino acids of human ZMYM3.
Immunogen sequence/protein sequence: PEVDHGPEGTLAWDAGDQTLEPGPGGQTPEVVPPDPGAGANSCSPEGLLEPLAPDSPITLQSPHIEEEETTSIATARRGSPGQEEELPQGQPQSPNAPPSPSVGETLGDGINSSQTKPGGSSPPAHPSLPGDGLTAKASEKPPERKRS
Protein accession: Q14202
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20178-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with ZMYM3 polyclonal antibody (Cat # PAB20178) shows strong nuclear positivity in neuronal cells.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZMYM3 polyclonal antibody now

Add to cart