BAIAP2L2 polyclonal antibody View larger

BAIAP2L2 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BAIAP2L2 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about BAIAP2L2 polyclonal antibody

Brand: Abnova
Reference: PAB20156
Product name: BAIAP2L2 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant BAIAP2L2.
Isotype: IgG
Gene id: 80115
Gene name: BAIAP2L2
Gene alias: FLJ22582
Gene description: BAI1-associated protein 2-like 2
Immunogen: Recombinant protein corresponding to amino acids of human BAIAP2L2.
Immunogen sequence/protein sequence: VVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKALEEGPVNPMTPVTPMTSMTSMSPMTPMNPGNELPSRSYPLRGSHSLDDLLDRPGNSIAPSEYWDGQSRSRTPSRVPSRAPSPAPPPLPSSRRSSMGSTAVATDVKKLMSSEQYPP
Protein accession: Q6UXY1
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20156-48-51-1.jpg
Application image note: Immunohistochemical staining of human cerebral cortex with BAIAP2L2 polyclonal antibody (Cat # PAB20156) shows strong nuclear and cytoplasmic positivity in neuronal cells at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy BAIAP2L2 polyclonal antibody now

Add to cart