Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB20130 |
Product name: | SLC22A17 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant SLC22A17. |
Isotype: | IgG |
Gene id: | 51310 |
Gene name: | SLC22A17 |
Gene alias: | BOCT|BOIT|NGALR|hBOIT |
Gene description: | solute carrier family 22, member 17 |
Immunogen: | Recombinant protein corresponding to amino acids of human SLC22A17. |
Immunogen sequence/protein sequence: | RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN |
Protein accession: | Q8WUG5 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:20-1:50) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human hippocampus with SLC22A17 polyclonal antibody (Cat # PAB20130) shows cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |
Publications: | Biochemical and structural characterization of the interaction between the Siderocalin NGAL/LCN2 and the N-terminal domain of its endocytic receptor SLC22A17.Cabedo Martinez AI, Weinhaupl K, Lee WK, Wolff NA, Storch B, Zerko S, Konrat R, Kozminski W, Breuker K, Thevenod F, Coudevylle N. J Biol Chem. 2015 Dec 3. |