SLC22A17 polyclonal antibody View larger

SLC22A17 polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SLC22A17 polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about SLC22A17 polyclonal antibody

Brand: Abnova
Reference: PAB20130
Product name: SLC22A17 polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant SLC22A17.
Isotype: IgG
Gene id: 51310
Gene name: SLC22A17
Gene alias: BOCT|BOIT|NGALR|hBOIT
Gene description: solute carrier family 22, member 17
Immunogen: Recombinant protein corresponding to amino acids of human SLC22A17.
Immunogen sequence/protein sequence: RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
Protein accession: Q8WUG5
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20130-48-223-1.jpg
Application image note: Immunohistochemical staining of human hippocampus with SLC22A17 polyclonal antibody (Cat # PAB20130) shows cytoplasmic positivity in neuronal cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice
Publications: Biochemical and structural characterization of the interaction between the Siderocalin NGAL/LCN2 and the N-terminal domain of its endocytic receptor SLC22A17.Cabedo Martinez AI, Weinhaupl K, Lee WK, Wolff NA, Storch B, Zerko S, Konrat R, Kozminski W, Breuker K, Thevenod F, Coudevylle N.
J Biol Chem. 2015 Dec 3.

Reviews

Buy SLC22A17 polyclonal antibody now

Add to cart