CNIH polyclonal antibody View larger

CNIH polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CNIH polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about CNIH polyclonal antibody

Brand: Abnova
Reference: PAB20122
Product name: CNIH polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant CNIH.
Isotype: IgG
Gene id: 10175
Gene name: CNIH
Gene alias: CNIH1|CNIL|MGC117156|TGAM77
Gene description: cornichon homolog (Drosophila)
Immunogen: Recombinant protein corresponding to amino acids of human CNIH.
Immunogen sequence/protein sequence: LLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKL
Protein accession: O95406
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20122-48-A1-1.jpg
Application image note: Immunohistochemical staining of human liver with CNIH polyclonal antibody (Cat # PAB20122) shows strong cytoplasmic positivity in hepatocytes at 1:50-1:200 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy CNIH polyclonal antibody now

Add to cart