Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | IHC-P |
Brand: | Abnova |
Reference: | PAB20103 |
Product name: | MBL2 polyclonal antibody |
Product description: | Rabbit polyclonal antibody raised against recombinant MBL2. |
Isotype: | IgG |
Gene id: | 4153 |
Gene name: | MBL2 |
Gene alias: | COLEC1|HSMBPC|MBL|MBP|MBP1|MGC116832|MGC116833 |
Gene description: | mannose-binding lectin (protein C) 2, soluble (opsonic defect) |
Immunogen: | Recombinant protein corresponding to amino acids of human MBL2. |
Immunogen sequence/protein sequence: | DGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH |
Protein accession: | P11226 |
Form: | Liquid |
Recommend dilutions: | Immunohistochemistry (1:200-1:500) The optimal working dilution should be determined by the end user. |
Storage buffer: | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide) |
Storage instruction: | Store at 4°C. For long term storage store at -20°C. Aliquot to avoid repeated freezing and thawing. |
Note: | This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunohistochemical staining of human liver with MBL2 polyclonal antibody (Cat # PAB20103) shows strong cytoplasmic positivity in hepatocytes at 1:200-1:500 dilution. |
Applications: | IHC-P |
Shipping condition: | Dry Ice |