PRX polyclonal antibody View larger

PRX polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRX polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about PRX polyclonal antibody

Brand: Abnova
Reference: PAB20091
Product name: PRX polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant PRX.
Isotype: IgG
Gene id: 57716
Gene name: PRX
Gene alias: CMT4F|KIAA1620
Gene description: periaxin
Immunogen: Recombinant protein corresponding to amino acids of human PRX.
Immunogen sequence/protein sequence: MKVPDMKLPEIKLPKVPEMAVPDVHLPEVQLPKVSEIRLPEMQVPKVPDVHLPKAPEVKLPRAPEVQLKATKAEQAEGMEFGFKMPKMTMPKLGRAESPSRGKPGEAGAEVSGKLVTLPCLQPEVDGEAHVGVPSLTLPSVELDL
Protein accession: Q9BXM0
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20091-48-A0-1.jpg
Application image note: Immunohistochemical staining of human kidney with PRX polyclonal antibody (Cat # PAB20091) shows strong cytoplasmic and nuclear positivity in cells in glomeruli at 1:200-1:500 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy PRX polyclonal antibody now

Add to cart