ZFY polyclonal antibody View larger

ZFY polyclonal antibody

New product

455,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFY polyclonal antibody

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIHC-P

More info about ZFY polyclonal antibody

Brand: Abnova
Reference: PAB20081
Product name: ZFY polyclonal antibody
Product description: Rabbit polyclonal antibody raised against recombinant ZFY.
Isotype: IgG
Gene id: 7544
Gene name: ZFY
Gene alias: MGC138710
Gene description: zinc finger protein, Y-linked
Immunogen: Recombinant protein corresponding to amino acids of human ZFY.
Immunogen sequence/protein sequence: IGPDGHPLTVYPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKAEKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHL
Protein accession: P08048
Form: Liquid
Recommend dilutions: Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Storage buffer: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Storage instruction: Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Note: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: PAB20081-48-I6-1.jpg
Application image note: Immunohistochemical staining of human duodenum with ZFY polyclonal antibody (Cat # PAB20081) shows moderate nuclear positivity in glandular cells at 1:20-1:50 dilution.
Applications: IHC-P
Shipping condition: Dry Ice

Reviews

Buy ZFY polyclonal antibody now

Add to cart